Often, you will encounter files in the PDB which have missing residues. Special care must be taken in this case, as MODELLER only reads the ATOM and HETATM records, not the SEQRES records, and so will not handle missing residues automatically.

One example is [attachment:pdb1qg8.ent PDB code `1qg8`], which is missing residues 134-136 and 218-231 (see the REMARK 465 lines in the PDB file). We can use Modeller to 'fill in' these missing residues by treating the original structure (without the missing residues) as a template, and building a comparative model using the full sequence.

First, we obtain the sequence of residues with known structure:

#!python
# Get the sequence of the 1qg8 PDB file, and write to an alignment file
code = '1qg8'

e = environ()
m = model(e, file=code)
aln = alignment(e)
aln.append_model(m, align_codes=code)
aln.write(file=code+'.seq')


This produces a sequence file, `1qg8.seq`:

>P1;1qg8
structureX:1qg8:   2 :A: 256 :A:undefined:undefined:-1.00:-1.00
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTR
YAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAP
CAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITEFVRNLPPQRNC
RELRESLKKLGMG*


From the PDB REMARKs or SEQRES records, we know the missing residues, so now we can make an alignment of the original 1qg8 structure (as the template), with gap characters corresponding to the missing residues, with the full sequence. This we place in a new alignment file, `alignment.ali`:

>P1;1qg8
structureX:1qg8:   2 :A: 256 :A:undefined:undefined:-1.00:-1.00
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTR
YAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLN---DIVKETVRPAAQVTW
NAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYIT---------
-----EFVRNLPPQRNCRELRESLKKLGMG*
>P1;1qg8_fill
sequence:1qg8_fill:   2 :A: 256 :A:undefined:undefined:-1.00:-1.00
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTR
YAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNENRDIVKETVRPAAQVTW
NAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITDQSIHFQLF
ELEKNEFVRNLPPQRNCRELRESLKKLGMG*


We can now use the standard Modeller `automodel` class to generate a model with all residues, and then to refine the loop regions:

#!python
from modeller.automodel import *    # Load the automodel class

log.verbose()
env = environ()

# directories for input atom files
env.io.atom_files_directory = './:../atom_files'

a = loopmodel(env, alnfile = 'alignment.ali',
              knowns = '1qg8', sequence = '1qg8_fill')
a.starting_model= 1
a.ending_model  = 1

a.loop.starting_model = 1
a.loop.ending_model   = 2
a.loop.md_level       = refine.fast

a.make()


/!\ Note that loop modeling will only refine the shorter of the two loops by default. You can modify the `select_loop_atoms` routine to refine both loops, but you are not likely to get good results with this long insertion. In this case, you should probably try to find another template for this part of the sequence, or impose secondary structure restraints if you have reason to believe the insertion is not a loop.