Inclusion of zinc atoms, Add_restraint problem?

Hi, I have a problem creating a model for a small protein with two zinc atoms. I use the ADD_RESTRAINT commands to create distance restrictions between the zincs and the residues attached to them. Looking at the log file, it looks that the restrictions are read without problems but at the end some ini file is read and I get an Atom index is out of bounds message. I am attaching the top, alignment and log file. I would appreciate any help. Thanks Alfredo Cardenas Top file: # Homology modelling by the MODELLER TOP routine 'model'. INCLUDE # Include the predefined TOP routines SET OUTPUT_CONTROL = 1 1 1 1 1 # uncomment to produce a large log file SET ALNFILE = 'alignment1.txt' # alignment filename SET KNOWNS = '1PTQ' # codes of the templates SET SEQUENCE = 'pkci' # code of the target #SET TOPOLOGY_MODEL = 1 SET HETATM_IO = on SET TOPLIB = '$(LIB)/top.lib' SET PARLIB = '$(LIB)/par.lib' #SET ATOM_FILES_DIRECTORY = './:../atom_files' # directories for input atom files SET STARTING_MODEL= 1 # index of the first model SET ENDING_MODEL = 1 # index of the last model # (determines how many models to calculate) CALL ROUTINE = 'model' # do homology modelling SUBROUTINE ROUTINE = 'special_restraints' ADD_RESTRAINT ATOM_IDS = 'SG:14' 'ZN:55', ; RESTRAINT_PARAMETERS = 3 1 1 27 2 2 0 3.0 0.1 ADD_RESTRAINT ATOM_IDS = 'SG:17' 'ZN:55', ; RESTRAINT_PARAMETERS = 3 1 1 27 2 2 0 3.0 0.1 ADD_RESTRAINT ATOM_IDS = 'NE2:39' 'ZN:55', ; RESTRAINT_PARAMETERS = 3 1 1 27 2 2 0 3.0 0.1 ADD_RESTRAINT ATOM_IDS = 'SG:42' 'ZN:55', ; RESTRAINT_PARAMETERS = 3 1 1 27 2 2 0 3.0 0.1 ADD_RESTRAINT ATOM_IDS = 'SG:31' 'ZN:54', ; RESTRAINT_PARAMETERS = 3 1 1 27 2 2 0 3.0 0.1 ADD_RESTRAINT ATOM_IDS = 'SG:34' 'ZN:54', ; RESTRAINT_PARAMETERS = 3 1 1 27 2 2 0 3.0 0.1 ADD_RESTRAINT ATOM_IDS = 'SG:50' 'ZN:54', ; RESTRAINT_PARAMETERS = 3 1 1 27 2 2 0 3.0 0.1 ADD_RESTRAINT ATOM_IDS = 'NE2:53' 'ZN:54', ; RESTRAINT_PARAMETERS = 3 1 1 27 2 2 0 3.0 0.1 RETURN END_SUBROUTINE Align file: C; alignment of catalytic domain ok PKCiota and PKCtheta >P1;1PTQ structureX:1PTQ:::::::: HRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC---/--* >P1;pkci sequence:pkci:::::::: HTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRH/zz* Log file: MODELLER 7v7, Sep 12, 2004 09:15pm PROTEIN STRUCTURE MODELLING BY SATISFACTION OF SPATIAL RESTRAINTS Copyright(c) 1989-2004 Andrej Sali All Rights Reserved Written by A. Sali with help from B. Webb, M.S. Madhusudhan, M-Y. Shen, M.A. Marti-Renom, N. Eswar, F. Alber, B. Oliva, A. Fiser, R. Sanchez, B. Yerkovich, A. Badretdinov, F. Melo, J.P. Overington, E. Feyfant University of California, San Francisco, USA Rockefeller University, New York, USA Harvard University, Cambridge, USA Imperial Cancer Research Fund, London, UK Birkbeck College, University of London, London, UK Kind, OS, HostName, Kernel, Processor: 4, Win2000 build 2195 Service Pack 4, C000826, uni, x86 Family 15 Model 2 Stepping 7 Date and time of compilation : 09/13/2004 17:17:22 Job starting time (YY/MM/DD HH:MM:SS): 2005/01/28 14:19:34.867 getprog_531W> ROUTINE redefined: special_restraints TOP_________> 108 746 SET ALNFILE = 'alignment1.txt' TOP_________> 109 747 SET KNOWNS = '1PTQ' TOP_________> 110 748 SET SEQUENCE = 'pkci' TOP_________> 111 749 SET HETATM_IO = ON TOP_________> 112 750 SET TOPLIB = '$(LIB)/top.lib' TOP_________> 113 751 SET PARLIB = '$(LIB)/par.lib' TOP_________> 114 752 SET STARTING_MODEL = 1 TOP_________> 115 753 SET ENDING_MODEL = 1 TOP_________> 116 754 CALL ROUTINE = 'model' TOP_________> 117 419 CALL ROUTINE = 'getnames' TOP_________> 118 531 STRING_IF STRING_ARGUMENTS = MODEL 'undefined', OPERATION; = 'EQ', THEN = 'STRING_OPERATE OPERATION = CONCATENA; TE, STRING_ARGUMENTS = SEQUENCE .ini, RESULT = MODEL' TOP_________> 119 532 STRING_IF STRING_ARGUMENTS = CSRFILE 'undefined', OPERATI; ON = 'EQ', THEN = 'STRING_OPERATE OPERATION = CONCATE; NATE, STRING_ARGUMENTS = SEQUENCE .rsr, RESULT = CSRFILE; ' TOP_________> 120 533 STRING_OPERATE OPERATION = 'CONCATENATE', ; STRING_ARGUMENTS = SEQUENCE '.sch', RESULT = SCHFILE TOP_________> 121 534 STRING_OPERATE OPERATION = 'CONCATENATE', ; STRING_ARGUMENTS = SEQUENCE '.mat', RESULT = MATRIX_FI; LE TOP_________> 122 535 SET ROOT_NAME = SEQUENCE TOP_________> 123 536 RETURN TOP_________> 124 420 CALL ROUTINE = 'homcsr' TOP_________> 125 112 READ_ALIGNMENT FILE = ALNFILE, ALIGN_CODES = KNOWNS SEQUE; NCE Dynamically allocated memory at amaxseq [B,kB,MB]: 84067 82.097 0.080 openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm Dynamically allocated memory at amaxbnd [B,kB,MB]: 1516107 1480.573 1.446 openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm read_al_374_> Non-standard residue type,position,sequence: z 54 2 read_al_374_> Non-standard residue type,position,sequence: z 55 2 Read the alignment from file : alignment1.txt Total number of alignment positions: 55 # Code #_Res #_Segm PDB_code Name ------------------------------------------------------------------------ ------- 1 1PTQ 50 1 1PTQ 2 pkci 55 2 pkci TOP_________> 126 113 STRING_IF STRING_ARGUMENTS = TOP_VERSION 'accelrys', OPER; ATION = 'ne', THEN = 'GO_TO __ACCELRYS1' TOP_________> 127 117 CHECK_ALIGNMENT check_a_343_> >> BEGINNING OF COMMAND openf5__224_> Open 11 OLD SEQUENTIAL ./\1PTQ.atm check_ali___> Checking the sequence-structure alignment. Implied target CA(i)-CA(i+1) distances longer than 8.0 angstroms: ALN_POS TMPL RID1 RID2 NAM1 NAM2 DIST ---------------------------------------------- END OF TABLE check_a_344_> << END OF COMMAND TOP_________> 128 118 CALL ROUTINE = GENERATE_METHOD TOP_________> 129 83 READ_ALIGNMENT FILE = ALNFILE, ALIGN_CODES = KNOWNS openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm Read the alignment from file : alignment1.txt Total number of alignment positions: 50 # Code #_Res #_Segm PDB_code Name ------------------------------------------------------------------------ ------- 1 1PTQ 50 1 1PTQ TOP_________> 130 84 READ_ALIGNMENT FILE = ALNFILE, ALIGN_CODES = KNOWNS openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm Read the alignment from file : alignment1.txt Total number of alignment positions: 50 # Code #_Res #_Segm PDB_code Name ------------------------------------------------------------------------ ------- 1 1PTQ 50 1 1PTQ TOP_________> 131 85 IF ARGUMENTS = INITIAL_MALIGN3D 0, OPERATION = 'EQ', THEN; = 'GO_TO NO_INITIAL_MALIGN3D' TOP_________> 132 88 READ_ALIGNMENT FILE = ALNFILE, ALIGN_CODES = KNOWNS SEQUE; NCE openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm read_al_374_> Non-standard residue type,position,sequence: z 54 2 read_al_374_> Non-standard residue type,position,sequence: z 55 2 Read the alignment from file : alignment1.txt Total number of alignment positions: 55 # Code #_Res #_Segm PDB_code Name ------------------------------------------------------------------------ ------- 1 1PTQ 50 1 1PTQ 2 pkci 55 2 pkci TOP_________> 133 89 READ_TOPOLOGY FILE = TOPLIB openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib\/top.lib read_to_238_> Reading CHARMM residue topology file version: 22 1 openf5__224_> Open 11 UNKNOWN SEQUENTIAL ${MODINSTALL7v7}/modlib/models.lib TOP_________> 134 90 READ_PARAMETERS FILE = PARLIB openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib\/par.lib Dynamically allocated memory at amattacns [B,kB,MB]: 1516657 1481.110 1.446 openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib\/par.lib rdparf__232_> parameters BONDS ANGLS DIHEDS IMPROPS MRFP MODE 227 561 661 112 0 0 TOP_________> 135 91 CALL ROUTINE = 'create_topology' TOP_________> 136 106 GENERATE_TOPOLOGY ADD_SEQUENCE = OFF getf_______W> RTF restraint not found in the atoms list: residue type, indices: 7 53 atom names : C +N atom indices : 884 0 getf_______W> RTF restraint not found in the atoms list: residue type, indices: 7 1 atom names : N -C CA H atom indices : 1 0 3 2 getf_______W> RTF restraint not found in the atoms list: residue type, indices: 7 53 atom names : C CA +N O atom indices : 884 871 0 885 mkilst______> segment topology constructed from sequence and RTF: segments residues atoms bonds angles dihedrals impropers: 1 53 885 894 0 0 284 patch_______> segment topology patched using RTF: 1 ; HIS ; NTER segments residues atoms bonds angles dihedrals impropers: 1 53 887 896 1609 2350 284 patch_______> segment topology patched using RTF: 53 ; HIS ; CTER segments residues atoms bonds angles dihedrals impropers: 1 53 888 897 1611 2353 285 genseg______> segment topology constructed from sequence and RTF: segments residues atoms bonds angles dihedrals impropers: 1 53 888 897 1611 2353 285 mkilst______> segment topology constructed from sequence and RTF: segments residues atoms bonds angles dihedrals impropers: 2 55 890 897 1611 2353 285 genseg______> segment topology constructed from sequence and RTF: segments residues atoms bonds angles dihedrals impropers: 2 55 890 897 1611 2353 285 TOP_________> 137 107 CALL ROUTINE = 'default_patches' TOP_________> 138 526 READ_ALIGNMENT FILE = ALNFILE, ALIGN_CODES = KNOWNS SEQUE; NCE openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm read_al_374_> Non-standard residue type,position,sequence: z 54 2 read_al_374_> Non-standard residue type,position,sequence: z 55 2 Read the alignment from file : alignment1.txt Total number of alignment positions: 55 # Code #_Res #_Segm PDB_code Name ------------------------------------------------------------------------ ------- 1 1PTQ 50 1 1PTQ 2 pkci 55 2 pkci TOP_________> 139 527 PATCH_SS_TEMPLATES TOP_________> 140 528 RETURN TOP_________> 141 108 CALL ROUTINE = 'special_patches' TOP_________> 142 523 RETURN TOP_________> 143 109 RETURN TOP_________> 144 92 TRANSFER_XYZ CLUSTER_CUT = -1.0 transfe_506_> MODEL is an average of all templates. transfe_511_> Number of templates for coordinate transfer: 1 After transfering coordinates of the equivalent template atoms, there are defined, undefined atoms in MODEL: 328 562 TOP_________> 145 93 BUILD_MODEL INITIALIZE_XYZ = OFF build___467W> All coordinates in MODEL have been assigned. build___468W> Some coordinates in MODEL are still undefined. build___464W> Inventing the MODEL coordinates. TOP_________> 146 94 WRITE_MODEL FILE = MODEL openf5__224_> Open 14 UNKNOWN SEQUENTIAL pkci.ini wrpdb2__568_> Residues, atoms, selected atoms: 55 890 890 TOP_________> 147 95 RETURN TOP_________> 148 119 IF ARGUMENTS = EXIT_STAGE 2, OPERATION = 'EQ', THEN = 'RE; TURN' TOP_________> 149 120 IF ARGUMENTS = CREATE_RESTRAINTS 0, OPERATION = 'EQ', THE; N ='GO_TO __SKIP_RSRS' TOP_________> 150 121 CALL ROUTINE = 'mkhomcsr' TOP_________> 151 126 MAKE_RESTRAINTS RESTRAINT_TYPE = 'stereo', ADD_RESTRAINTS; = OFF Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: stereo r_stere_607W> Cannot find params in params file: CHARMM atoms : NY CA CPT H IUPAC atoms : NE1 CD1 CE2 HE1 Atom indices : 367 365 369 368 Residues : TRP TRP TRP TRP addprm__440W> Adding params (mean,force,period): 1.0268 60.0000 0 For atoms: NY CA CPT H r_stere_606_> Stereochemical restraints were constructed from RTF & PRMF. Added bond,angle,dihedral,improper restraints : 897 1611 1936 285 Total number of restraints before, now : 0 4729 make_re_422_> Number of previous, current restraints : 0 4729 make_re_423_> Number of previous, current selected restraints: 0 4729 TOP_________> 152 127 READ_ALIGNMENT FILE = ALNFILE, ALIGN_CODES = KNOWNS SEQUE; NCE openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm openf5__224_> Open 20 OLD SEQUENTIAL alignment1.txt openf5__224_> Open 13 OLD SEQUENTIAL ./\1PTQ.atm read_al_374_> Non-standard residue type,position,sequence: z 54 2 read_al_374_> Non-standard residue type,position,sequence: z 55 2 Read the alignment from file : alignment1.txt Total number of alignment positions: 55 # Code #_Res #_Segm PDB_code Name ------------------------------------------------------------------------ ------- 1 1PTQ 50 1 1PTQ 2 pkci 55 2 pkci TOP_________> 153 128 MAKE_RESTRAINTS RESTRAINT_TYPE = 'phi-psi_binormal', ADD_; RESTRAINTS = ON Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: phi-psi_binormal openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/mdt.ini openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/mnch1.bin initmdt_400_> Distance function type: 1 openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/mnch1.mdt irddata_401_> USER SYMMETRY, SYMMETRY: 1 T SYMMETRIC = .T. ==> NALN*NALN/2 SYMMETRIC = .F. ==> NALN*NALN All protein pairs always generated. getdata_643_> Protein accepted: 1PTQ getdata_289_> Proteins (all/accepted): 1 1 make_re_422_> Number of previous, current restraints : 4729 4780 make_re_423_> Number of previous, current selected restraints: 4729 4780 TOP_________> 154 129 SET SPLINE_RANGE = 4.0, SPLINE_DX = 0.3, SPLINE_MIN_POINT; S = 5 TOP_________> 155 130 MAKE_RESTRAINTS RESTRAINT_TYPE = 'omega_dihedral', ADD_RE; STRAINTS = ON Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: omega_dihedral openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/mdt.ini openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/omega.bin initmdt_400_> Distance function type: 1 openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/omega.mdt irddata_401_> USER SYMMETRY, SYMMETRY: 1 T SYMMETRIC = .T. ==> NALN*NALN/2 SYMMETRIC = .F. ==> NALN*NALN All protein pairs always generated. getdata_643_> Protein accepted: 1PTQ getdata_289_> Proteins (all/accepted): 1 1 delete__442E> One or more atoms absent from MODEL: O: 53: C: 53: N: 54: CA: 54: delete__442E> One or more atoms absent from MODEL: O: 54: C: 54: N: 55: CA: 55: omgdel__425W> Unselected all O C +N +CA dihedrals: 52 make_re_422_> Number of previous, current restraints : 4780 4832 make_re_423_> Number of previous, current selected restraints: 4780 4780 TOP_________> 156 131 MAKE_RESTRAINTS RESTRAINT_TYPE = 'chi1_dihedral', ADD_RES; TRAINTS = ON Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: chi1_dihedral openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/mdt.ini openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/chi1234.bin initmdt_400_> Distance function type: 1 openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/chi1.mdt irddata_401_> USER SYMMETRY, SYMMETRY: 1 T SYMMETRIC = .T. ==> NALN*NALN/2 SYMMETRIC = .F. ==> NALN*NALN All protein pairs always generated. getdata_643_> Protein accepted: 1PTQ getdata_289_> Proteins (all/accepted): 1 1 make_re_422_> Number of previous, current restraints : 4832 4878 make_re_423_> Number of previous, current selected restraints: 4780 4826 TOP_________> 157 132 MAKE_RESTRAINTS RESTRAINT_TYPE = 'chi2_dihedral', ADD_RES; TRAINTS = ON Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: chi2_dihedral openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/mdt.ini openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/chi1234.bin initmdt_400_> Distance function type: 1 openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/chi2.mdt irddata_401_> USER SYMMETRY, SYMMETRY: 1 T SYMMETRIC = .T. ==> NALN*NALN/2 SYMMETRIC = .F. ==> NALN*NALN All protein pairs always generated. getdata_643_> Protein accepted: 1PTQ getdata_289_> Proteins (all/accepted): 1 1 make_re_422_> Number of previous, current restraints : 4878 4913 make_re_423_> Number of previous, current selected restraints: 4826 4861 TOP_________> 158 133 MAKE_RESTRAINTS RESTRAINT_TYPE = 'chi3_dihedral', ADD_RES; TRAINTS = ON Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: chi3_dihedral openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/mdt.ini openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/chi1234.bin initmdt_400_> Distance function type: 1 openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/chi3.mdt irddata_401_> USER SYMMETRY, SYMMETRY: 1 T SYMMETRIC = .T. ==> NALN*NALN/2 SYMMETRIC = .F. ==> NALN*NALN All protein pairs always generated. getdata_643_> Protein accepted: 1PTQ getdata_289_> Proteins (all/accepted): 1 1 make_re_422_> Number of previous, current restraints : 4913 4928 make_re_423_> Number of previous, current selected restraints: 4861 4876 TOP_________> 159 134 MAKE_RESTRAINTS RESTRAINT_TYPE = 'chi4_dihedral', ADD_RES; TRAINTS = ON Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: chi4_dihedral openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/mdt.ini openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/chi1234.bin initmdt_400_> Distance function type: 1 openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/chi4.mdt irddata_401_> USER SYMMETRY, SYMMETRY: 1 T SYMMETRIC = .T. ==> NALN*NALN/2 SYMMETRIC = .F. ==> NALN*NALN All protein pairs always generated. mdtrsr__446W> A potential that relies on one protein is used, yet you have at least one known structure available. MDT, not library, potential is used. getdata_643_> Protein accepted: 1PTQ getdata_289_> Proteins (all/accepted): 1 1 make_re_422_> Number of previous, current restraints : 4928 4940 make_re_423_> Number of previous, current selected restraints: 4876 4888 TOP_________> 160 135 SET SPLINE_RANGE = 4.0, SPLINE_DX = 0.7, SPLINE_MIN_POINT; S = 5 TOP_________> 161 136 SET RES_TYPES = 'STD' TOP_________> 162 137 SET DISTANCE_RSR_MODEL = 5, MAXIMAL_DISTANCE = MAX_CA-CA_; DISTANCE TOP_________> 163 138 SET RESIDUE_SPAN_RANGE = 2 99999, RESIDUE_SPAN_SIGN = ON TOP_________> 164 139 SET RESTRAINT_GROUP = 9 TOP_________> 165 140 PICK_ATOMS PICK_ATOMS_SET = 2, ATOM_TYPES = 'CA' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : CA Residue types to be searched for (RES_TYPES) : STD Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 53 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 53 : HIS 53 TOP_________> 166 141 PICK_ATOMS PICK_ATOMS_SET = 3, ATOM_TYPES = 'CA' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : CA Residue types to be searched for (RES_TYPES) : STD Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 53 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 53 : HIS 53 TOP_________> 167 142 MAKE_RESTRAINTS RESTRAINT_TYPE = 'distance', ADD_RESTRAIN; TS = 'ON' Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: distance make_re_422_> Number of previous, current restraints : 4940 5639 make_re_423_> Number of previous, current selected restraints: 4888 5587 TOP_________> 168 143 SET DISTANCE_RSR_MODEL = 6, MAXIMAL_DISTANCE = MAX_N-O_DI; STANCE TOP_________> 169 144 SET RESIDUE_SPAN_RANGE = 2 99999, RESIDUE_SPAN_SIGN = OFF TOP_________> 170 145 SET RESTRAINT_GROUP = 10 TOP_________> 171 146 PICK_ATOMS PICK_ATOMS_SET = 2, ATOM_TYPES = 'N' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : N Residue types to be searched for (RES_TYPES) : STD Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 53 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 53 : HIS 53 TOP_________> 172 147 PICK_ATOMS PICK_ATOMS_SET = 3, ATOM_TYPES = 'O' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : O Residue types to be searched for (RES_TYPES) : STD Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 53 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 53 : HIS 53 TOP_________> 173 148 MAKE_RESTRAINTS RESTRAINT_TYPE = 'distance', ADD_RESTRAIN; TS = 'ON' Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: distance make_re_422_> Number of previous, current restraints : 5639 6463 make_re_423_> Number of previous, current selected restraints: 5587 6411 TOP_________> 174 149 SET DISTANCE_RSR_MODEL = 6, MAXIMAL_DISTANCE = MAX_SC-MC_; DISTANCE TOP_________> 175 150 SET RESIDUE_SPAN_RANGE = 1 2, RESIDUE_SPAN_SIGN = OFF TOP_________> 176 151 SET RESTRAINT_GROUP = 23, RESTRAINT_STDEV = 0.5 1.5 TOP_________> 177 152 PICK_ATOMS PICK_ATOMS_SET = 2, ATOM_TYPES = 'SDCH' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : SDCH Residue types to be searched for (RES_TYPES) : STD Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 676 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 53 : HIS 53 TOP_________> 178 153 PICK_ATOMS PICK_ATOMS_SET = 3, ATOM_TYPES = 'MNCH' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : MNCH Residue types to be searched for (RES_TYPES) : STD Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 212 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 53 : HIS 53 TOP_________> 179 154 MAKE_RESTRAINTS RESTRAINT_TYPE = 'distance', ADD_RESTRAIN; TS = 'ON' Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: distance make_re_422_> Number of previous, current restraints : 6463 7008 make_re_423_> Number of previous, current selected restraints: 6411 6956 TOP_________> 180 155 SET DISTANCE_RSR_MODEL = 6, MAXIMAL_DISTANCE = MAX_SC-SC_; DISTANCE TOP_________> 181 156 SET RESIDUE_SPAN_RANGE = 2 99999, RESIDUE_SPAN_SIGN = ON TOP_________> 182 157 SET RESTRAINT_GROUP = 26, RESTRAINT_STDEV = 0.5 2.0 TOP_________> 183 158 PICK_ATOMS PICK_ATOMS_SET = 2, ATOM_TYPES = 'SDCH' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : SDCH Residue types to be searched for (RES_TYPES) : STD Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 676 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 53 : HIS 53 TOP_________> 184 159 PICK_ATOMS PICK_ATOMS_SET = 3, ATOM_TYPES = 'SDCH' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : SDCH Residue types to be searched for (RES_TYPES) : STD Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 676 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 53 : HIS 53 TOP_________> 185 160 MAKE_RESTRAINTS RESTRAINT_TYPE = 'distance', ADD_RESTRAIN; TS = 'ON' Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: distance make_re_422_> Number of previous, current restraints : 7008 7226 make_re_423_> Number of previous, current selected restraints: 6956 7174 TOP_________> 186 161 CALL ROUTINE = 'hetatm_restraints' TOP_________> 187 170 SET RESTRAINT_TYPE = 'distance' TOP_________> 188 171 SET DISTANCE_RSR_MODEL = 7 TOP_________> 189 172 SET MAXIMAL_DISTANCE = 7.0 TOP_________> 190 173 SET ADD_RESTRAINTS = ON TOP_________> 191 174 SET RESTRAINT_GROUP = 27 TOP_________> 192 175 SET RESTRAINT_STDEV = 0.2 0.0 TOP_________> 193 176 SET RESIDUE_SPAN_RANGE = 0 99999, RESIDUE_SPAN_SIGN = OFF TOP_________> 194 177 PICK_ATOMS PICK_ATOMS_SET = 2, ATOM_TYPES = 'ALL', RES_TY; PES = 'ALL' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : ALL Residue types to be searched for (RES_TYPES) : ALL Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 890 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 55 : ZN2 55 TOP_________> 195 178 PICK_ATOMS PICK_ATOMS_SET = 3, ATOM_TYPES = 'ALL', RES_TY; PES = 'HET' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : ALL Residue types to be searched for (RES_TYPES) : HET Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 2 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 54 : ZN2 --- 55 : ZN2 2 TOP_________> 196 179 MAKE_RESTRAINTS Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: distance make_re_422_> Number of previous, current restraints : 7226 7226 make_re_423_> Number of previous, current selected restraints: 7174 7174 TOP_________> 197 180 RETURN TOP_________> 198 162 CALL ROUTINE = 'blk_restraints' TOP_________> 199 183 SET RESTRAINT_TYPE = 'distance' TOP_________> 200 184 SET DISTANCE_RSR_MODEL = 7 TOP_________> 201 185 SET MAXIMAL_DISTANCE = 10.0 TOP_________> 202 186 SET ADD_RESTRAINTS = ON TOP_________> 203 187 SET RESTRAINT_GROUP = 27 TOP_________> 204 188 SET RESTRAINT_STDEV = 0.05 0.0 TOP_________> 205 189 SET RESIDUE_SPAN_RANGE = 0 0, RESIDUE_SPAN_SIGN = ON TOP_________> 206 190 PICK_ATOMS PICK_ATOMS_SET = 2, ATOM_TYPES = 'ALL', RES_T; YPES = 'BLK' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : ALL Residue types to be searched for (RES_TYPES) : BLK Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 0 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN TOP_________> 207 191 PICK_ATOMS PICK_ATOMS_SET = 3, ATOM_TYPES = 'ALL', RES_T; YPES = 'BLK' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : ALL Residue types to be searched for (RES_TYPES) : BLK Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 0 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN TOP_________> 208 192 MAKE_RESTRAINTS Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: distance make_re_422_> Number of previous, current restraints : 7226 7226 make_re_423_> Number of previous, current selected restraints: 7174 7174 TOP_________> 209 193 SET RESTRAINT_STDEV = 0.2 0.0 TOP_________> 210 194 SET RESIDUE_SPAN_RANGE = 1 99999, RESIDUE_SPAN_SIGN = OFF TOP_________> 211 195 PICK_ATOMS PICK_ATOMS_SET = 2, ATOM_TYPES = 'CA', RES_TY; PES = 'ALL' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : CA Residue types to be searched for (RES_TYPES) : ALL Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 53 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 53 : HIS 53 TOP_________> 212 196 PICK_ATOMS PICK_ATOMS_SET = 3, ATOM_TYPES = 'ALL', RES_TY; PES = 'BLK' Number of atoms to choose from, total : 890 890 Atom types to be searched for (ATOM_TYPES) : ALL Residue types to be searched for (RES_TYPES) : BLK Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): INITIALIZE SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 0 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN TOP_________> 213 197 MAKE_RESTRAINTS Dynamically allocated memory at amprmcns [B,kB,MB]: 5191489 5069.813 4.951 make_re_417_> Restraint type to be calculated: distance make_re_422_> Number of previous, current restraints : 7226 7226 make_re_423_> Number of previous, current selected restraints: 7174 7174 TOP_________> 214 198 DELETE_ALIGNMENT TOP_________> 215 199 RETURN Dynamically allocated memory at amaxseq [B,kB,MB]: 5097041 4977.579 4.861 TOP_________> 216 163 CALL ROUTINE = 'special_restraints' TOP_________> 217 756 ADD_RESTRAINT ATOM_IDS = 'SG:14' 'ZN:55', RESTRAINT_PARAM; ETERS = 3 1 1 27 2 2 0 3.0 0.1 Dynamically allocated memory at amprmcns [B,kB,MB]: 5097191 4977.726 4.861 TOP_________> 218 757 ADD_RESTRAINT ATOM_IDS = 'SG:17' 'ZN:55', RESTRAINT_PARAM; ETERS = 3 1 1 27 2 2 0 3.0 0.1 Dynamically allocated memory at amprmcns [B,kB,MB]: 5097191 4977.726 4.861 TOP_________> 219 758 ADD_RESTRAINT ATOM_IDS = 'NE2:39' 'ZN:55', RESTRAINT_PARA; METERS = 3 1 1 27 2 2 0 3.0 0.1 Dynamically allocated memory at amprmcns [B,kB,MB]: 5097191 4977.726 4.861 TOP_________> 220 759 ADD_RESTRAINT ATOM_IDS = 'SG:42' 'ZN:55', RESTRAINT_PARAM; ETERS = 3 1 1 27 2 2 0 3.0 0.1 Dynamically allocated memory at amprmcns [B,kB,MB]: 5097191 4977.726 4.861 TOP_________> 221 760 ADD_RESTRAINT ATOM_IDS = 'SG:31' 'ZN:54', RESTRAINT_PARAM; ETERS = 3 1 1 27 2 2 0 3.0 0.1 Dynamically allocated memory at amprmcns [B,kB,MB]: 5097191 4977.726 4.861 TOP_________> 222 761 ADD_RESTRAINT ATOM_IDS = 'SG:34' 'ZN:54', RESTRAINT_PARAM; ETERS = 3 1 1 27 2 2 0 3.0 0.1 Dynamically allocated memory at amprmcns [B,kB,MB]: 5097191 4977.726 4.861 TOP_________> 223 762 ADD_RESTRAINT ATOM_IDS = 'SG:50' 'ZN:54', RESTRAINT_PARAM; ETERS = 3 1 1 27 2 2 0 3.0 0.1 Dynamically allocated memory at amprmcns [B,kB,MB]: 5097191 4977.726 4.861 TOP_________> 224 763 ADD_RESTRAINT ATOM_IDS = 'NE2:53' 'ZN:54', RESTRAINT_PARA; METERS = 3 1 1 27 2 2 0 3.0 0.1 Dynamically allocated memory at amprmcns [B,kB,MB]: 5097191 4977.726 4.861 TOP_________> 225 764 RETURN TOP_________> 226 164 CONDENSE_RESTRAINTS delete__443_> Restraints marked for deletion were removed. Total number of restraints before, now: 7234 6845 TOP_________> 227 165 WRITE_RESTRAINTS FILE = CSRFILE openf5__224_> Open 14 UNKNOWN SEQUENTIAL pkci.rsr TOP_________> 228 166 SET RESIDUE_SPAN_RANGE = -999 -999, RESIDUE_SPAN_SIGN = O; N top_mod_451W> Requested schedule step not available: 0 SCHEDULE_STEP set to N_SCHEDULE. TOP_________> 229 167 RETURN TOP_________> 230 122 LABEL __SKIP_RSRS TOP_________> 231 123 RETURN TOP_________> 232 421 IF ARGUMENTS = EXIT_STAGE 1, OPERATION = 'GE', THEN = 'RE; TURN' TOP_________> 233 422 CALL ROUTINE = 'rd_restraints' TOP_________> 234 276 READ_RESTRAINTS FILE = CSRFILE, ADD_RESTRAINTS = 'off' openf5__224_> Open 11 OLD SEQUENTIAL pkci.rsr openf5__224_> Open 11 OLD SEQUENTIAL pkci.rsr rdcsr2__307_> Number of restraints read : 0 Number of excluded pairs read: 0 Number of pseudo atoms read : 0 Dynamically allocated memory at amprmcns [B,kB,MB]: 5097191 4977.726 4.861 openf5__224_> Open 11 OLD SEQUENTIAL pkci.rsr openf5__224_> Open 11 OLD SEQUENTIAL pkci.rsr rdcsr2__307_> Number of restraints read : 0 Number of excluded pairs read: 0 Number of pseudo atoms read : 0 rdcsrs__304_> Restraints in memory, selected restraints: 6845 6845 Explicitly excluded atom pairs in memory : 0 Pseudo atoms in memory : 0 TOP_________> 235 277 RETURN TOP_________> 236 423 CALL ROUTINE = 'multiple_models' TOP_________> 237 202 DO ID2 = STARTING_MODEL ENDING_MODEL 1 TOP_________> 238 203 SET FINAL_MODEL = 'default' TOP_________> 239 204 CALL ROUTINE = 'single_model' TOP_________> 240 215 SET MAX_ITERATIONS = MAX_VAR_ITERATIONS TOP_________> 241 216 SET ID1 = 0 TOP_________> 242 217 SWITCH_TRACE FILE = 'default', FILE_EXT = '', FILE_ID = '; .D' openf5__224_> Open 18 UNKNOWN SEQUENTIAL pkci.D00000001 TOP_________> 243 218 READ_MODEL FILE = MODEL openf5__224_> Open 11 OLD SEQUENTIAL pkci.ini openf5__224_> Open 11 OLD SEQUENTIAL pkci.ini rdatm___297_> Segments, residues, atoms: 2 55 438 rdatm___298_> Segment: 1 1 53 436 rdatm___298_> Segment: 2 54 55 2 TOP_________> 244 219 CALL ROUTINE = 'select_atoms' TOP_________> 245 288 PICK_ATOMS SELECTION_SEGMENT ='@:@' 'X:X', SELECTION_SEAR; CH ='segment', PICK_ATOMS_SET =1, RES_TYPES =; 'all', ATOM_TYPES ='all', SELECTION_FROM ='a; ll', SELECTION_STATUS ='initialize' Number of atoms to choose from, total : 438 438 Atom types to be searched for (ATOM_TYPES) : all Residue types to be searched for (RES_TYPES) : all Selection mode (SELECTION_MODE) : ATOM What to do with atoms & sets (SELECTION_STATUS): initialize SEGMENT search; residue range (2i5,2a5) : 1 55 1: 55: selatm__462_> Number of selected atoms : 438 List of segments of contiguous residues with at least one selected atom: SEGMENT RESNUM AA --- RESNUM AA LEN 1 1 : HIS --- 55 : ZN2 55 TOP_________> 246 289 RETURN TOP_________> 247 220 CALL ROUTINE = RAND_METHOD TOP_________> 248 272 RANDOMIZE_XYZ randomi_498_> Atoms,selected atoms,random_seed,amplitude: 438 438 1 4.0000 randomi_496_> Amplitude is > 0; randomization is done. TOP_________> 249 273 RETURN TOP_________> 250 221 MAKE_SCHEDULE openf5__224_> Open 11 OLD SEQUENTIAL ${MODINSTALL7v7}/modlib/sched.lib TOP_________> 251 222 WRITE_SCHEDULE FILE = SCHFILE openf5__224_> Open 14 UNKNOWN SEQUENTIAL pkci.sch TOP_________> 252 223 IF ARGUMENTS = WRITE_INTERMEDIATES 1, OPERATION = 'EQ', ; THEN = 'WRITE_MODEL FILE = default, FILE_EXT = PDB_E; XT', FILE_ID = '.B' TOP_________> 253 224 DO IREPEAT = 1 REPEAT_OPTIMIZATION 1 TOP_________> 254 225 CALL ROUTINE = 'single_model_pass' TOP_________> 255 252 DO SCHEDULE_STEP = 1 N_SCHEDULE 1 TOP_________> 256 253 OPERATE ARGUMENTS = ID1 1, OPERATION = 'SUM', RESULT = ID; 1 TOP_________> 257 254 PICK_RESTRAINTS ADD_RESTRAINTS = OFF csrrng__299E> Atom index is out of bounds: 441 438 recover____E> ERROR_STATUS >= STOP_ON_ERROR: 1 1 Dynamically allocated memory at finish [B,kB,MB]: 5094825 4975.415 4.859 Starting time : 2005/01/28 14:19:34.867 Closing time : 2005/01/28 14:19:42.305 Total CPU time [seconds] : 5.45 ************************************************************ Alfredo Cardenas Assistant Professor Department of Chemistry University of South Florida 4202 E. Fowler Ave, SCA 400 Tampa, FL 33620-5250 Phone: (813) 974-1591 Fax: (813) 974-1733 ************************************************************

Cardenas, Alfredo wrote: > I have a problem creating a model for a small protein with two zinc > atoms. I use the ADD_RESTRAINT commands to create distance restrictions > between the zincs and the residues attached to them. Looking at the log > file, it looks that the restrictions are read without problems but at > the end some ini file is read and I get an Atom index is out of bounds > message. I am attaching the top, alignment and log file. I would > appreciate any help. You should check your initial model file (the .ini file) to make sure that the atom numbers you've given in your restraints match the model. They must match the model, not the template. Ben Webb, Modeller Caretaker -- modeller-care@salilab.org http://www.salilab.org/modeller/ Modeller mail list: http://salilab.org/mailman/listinfo/modeller_usage
participants (2)
-
Cardenas, Alfredo
-
Modeller Caretaker