Re: multiple and not overlapping templates

Dear Dr. Andras Fiser,
Sorry for replying you late.
Thank you for your top and alignment files. They are very helpful. To compare your top file with mine, I found that I used a comma between two knows files: SET KNOWNS='template1, template2' although I don't know if it really matter.
Another problem was found by using the debug option: SET OUTPUT_CONTROL= 1 1 1 1. Modeller complained that one of my template was unacceptable, probably that was because its low resolution (2.6 or something) and too many missing atoms. After changing to another template, I got model. Thank you for your help.
Sincerely,
Xiao-Ping
At 07:05 PM 3/28/00 -0500, you wrote: > > Dear Xiao-Ping , > > It is not very fruitful, if you are not showing what exactly you are dealing > with. > > As a last help I send one of mine last application for the very same topic, > hope it helps. > a top file and an alignment file. Structures were generataed without any > problem. > > best wishes, > > Andras > > ########################################### > > INCLUDE > SET OUTPUT_CONTROL= 1 1 1 1 > SET ALNFILE='tetu.pir' > SET KNOWNS='2abc3' '2abc2' > SET SEQUENCE= 'tetu' > SET STARTING_MODEL= 1 > SET ENDING_MODEL = 30 > > CALL ROUTINE = 'model' > > > SUBROUTINE ROUTINE = 'transfer_xyz' > > # SET ALIGNMENT_FORMAT = 'PIR' > ## READ_ALIGNMENT FILE = ALNFILE, ALIGN_CODES = KNOWNS > ## MALIGN3D FIT = off, GAP_PENALTIES_3D = 0 4 > READ_ALIGNMENT FILE = ALNFILE, ALIGN_CODES = KNOWNS SEQUENCE > > READ_TOPOLOGY FILE = TOPLIB > READ_PARAMETERS FILE = PARLIB > > CALL ROUTINE = 'create_topology' > > TRANSFER_XYZ CLUSTER_CUT = -1.0 > BUILD_MODEL INITIALIZE_XYZ = OFF > > WRITE_MODEL FILE = MODEL > > RETURN > END_SUBROUTINE > ################################################## > > >P1;2abc3 > structureX:2ezm3:55::99::::: > ----YPSDNEEFDPHEQEDKLADPHEQCEFDCDPYPSDNEEDYPSHEQC----------- > -----------------------------------------* > >P1;2abc2 > structureX:2ezm2:5::48::::: > -------------------------------------------------------SQTCY > LSDKEYHRTCNMKHGSDFEQAPLPWDFHGKLMNYTELKS--* > >P1;tetu > sequence:tetu:::::::: > DCDPKLADNEEDEFDCDPNEEFDPHEDKLADPHEQCEFDCDPYPSDNEEDYPSDNEEDKL > NSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKYE* > > ################################################# > > > -- > , > Andras Fiser, PhD # phone: (212) 327 7206 > The Rockefeller University # fax: (212) 327 7540 > Box 270, 1230 York Avenue # e-mail:fisera@rockefeller.edu > New York, NY 10021-6399, USA # http://salilab.org/~andras
------------------------------------------------ Xiao-Ping Zhang Department of Biochemistry Stockholm University 106 91 Stockholm Sweden
Phone: 46-08-162582 / 162472 Fax: 46-08-153679 e-mail: zhang@biokemi.su.se
participants (1)
-
Xiao-Ping Zhang