Hi, I am using modeller 6v2. I have the following file: >P1;1sta sequence:1sta:1:@:260:@:aldolase:staca:2.00:-1.00 NQEQFDKIKNGKGFIAALDQSGGSTPKALKDYGVEENEYSNDEEMFNLVHDMRTRIITSPAFNGEKILGAILFEQTMDR EVEGKYTGSYLADKGIVPFLKVDKGLAEEADGVQLMKPIPDLDKLLDRANERGIFGTKMRSNILENNKEAIEKVVKQQF EVAKEIIAAGLVPIIEPEVNINAKDKEAIEANLAEAIKAELDNLKKDQYVMLKLTIPTKVNAYSELIEHPQVIRVVALS GGYSRDEANKILKQNDGLIASFSRALVSDLNAQQSDAEFNEKLQEAIDTIFDASVNKA* I am trying to run modeller for SEARCH, ALIGN2D, MALIGN....commands but everytime I have a reply for wrong command. a). Do I have to save this file into a particular directory? b). Do I have to write mod or mod6v2 together with the file to run the program? Any indication? Christos _________________________________________________________________ MSN 8 with e-mail virus protection service: 2 months FREE* http://join.msn.com/?page=features/virus