TypeError: restraint_group should be a physical_type object

Hi,
I try to do homology modeling by the automodel class. I get this error:
File "/usr/lib/modeller9.12/modlib/modeller/modeller/restraints.py", line 170, in make_distance raise TypeError("restraint_group should be a physical_type object")
I used mod9.12 on Ubuntu 12.04 with python2.7, with those script and alignment file:
***************************** # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class
log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in
# directories for input atom files env.io.atom_files_directory = ['.', '../atom_files']
a = automodel(env, alnfile = '1FLZ-WT-MU.ali', # alignment filename knowns = '1FLZ', # codes of the templates sequence = '1FLZ-H15Y-H206R') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling
*****************************
>P1;1FLZ structureX:1FLZ: 5 :A:229 :A:undefined:undefined:-1.00:-1.00 LTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIA IPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLW GSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE*
>P1;1FLZ-H15Y-H206R sequence:1FLZ-H15Y-H206R: : : : ::: 0.00: 0.00 LTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIA IPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLW GSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDWMPVLPAESE*
*****************************
Where could this error come from? Thanks a lot in advance,
Isaure

On 12/4/13 1:51 AM, Isaure Chauvot de Beauchene wrote: > I try to do homology modeling by the automodel class. I get this error: > > File "/usr/lib/modeller9.12/modlib/modeller/modeller/restraints.py", > line 170, in make_distance > raise TypeError("restraint_group should be a physical_type object")
Your script looks pretty normal to me. I'd be very interested to see the full Python traceback. This error indicates that you've called Restraints.make_distance() with an invalid restraint_group, but I don't see any such calls in your script (automodel does call it, but with valid restraint groups). So I'm not sure how you're getting this error, unless your copy of Modeller has been modified in an unusual way.
Ben Webb, Modeller Caretaker
participants (2)
-
Isaure Chauvot de Beauchene
-
Modeller Caretaker