![](https://secure.gravatar.com/avatar/626a92958758f9d4d56fc7a6c750bc28.jpg?s=120&d=mm&r=g)
Hello Yuan,
MODELLER should have given you a message about where the alignment is different from the PDB.
Can you paste it here?
Regards,
João [ .. ] Rodrigues
(Blog) http://doeidoei.wordpress.com (MSN) always_asleep_@hotmail.com (Skype) rodrigues.jglm
On Mon, Nov 9, 2009 at 12:17 PM, SHANG Yuan spl@ust.hk wrote:
> Hi,all. > I'm new to Modeller. Since I suspect the align result of "align2d()" > function, so I just simple recruited a multiple alignment of a domain > family, and then I create the "*.ali" file by hand. > But when I try to run "automodel" module, and it indicates "E> Sequence > difference between alignment and pdb :". > I'm sure my sequence in the alignment and pdb are the same since I have > succeeded by using the alignment file created by "align2d()" function. > I paste my own alignment below: > > >P1;myo10fermA > structureX:myo10ferm.pdb: 197 :A:+213 :A:::-1.00:-1.00 > ---EMTSTVYCHGGGSCKITINSHTTAGEVVEKLIAGLAMADSANMFALFEYNGHVDKAIESR-TVVADVLAKFE > KLAATSEVGDLP--WKFYFKLYCFLDTDNVPKDSVEFA-FMFEQAHEAVIHGHHPAP-EENLQVLAALRLQYLQG > DYTLH-AAIPPLEEVYSLARLKAR-AAAAEEVS--SARASIIDKWRKF-QGMNQAQAMAKYMALIKEWPGYGSTL > F* > > >P1;myo7f > sequence:myo7f: : : : ::: 0.00: 0.00 > SKKPIMLPVTFMDGTTKTLLTDSATTARELCNALADKISL-KDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCE > QYAKEQGAQERNAPWRLFFRKEVFTPW-HNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYG > SEMILE------RLLSLVPTYIPDREITPLKN-LEKWAQLAIAAHKKGIYAQRRTDSQ-KVKEDVVNYARFKWPL > L* > > > And the alignment file created by "align2d()":(This works well with > automodel) > > >P1;myo10fermA > structureX:myo10ferm.pdb: 197 :A:+213 :A:::-1.00:-1.00 > ---EMTSTVYCHGGGSCKITINSHTTAGEVVEKLIAGLAMADSANMFALFEYNGHVDKAIESRTVVADVLAKFEK > LAATSEV--GDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHP-APEENLQVLAALRLQYLQGDY > TLHAAIPPLEEVYSLARLKAR/A/AAAEEVSSARASIIDKWRKFQGMNQAQAMAKYMALIKEWPGYGSTLF* > > >P1;myo7f > sequence:myo7f: : : : ::: 0.00: 0.00 > SKKPIMLPVTFMDGTTKTLLTDSATTARELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQ > YAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSE > MILERLLSLVPTYIPDREITP-L-KNLEKWAQLAIAAHKKGIYAQRRTDSQKVKE--DVVN-YARFKWPLL* > > > > Any advice will be welcome.and Thanks in advance. > > > Yuan SHANG > > _______________________________________________ > modeller_usage mailing list > modeller_usage@salilab.org > https://salilab.org/mailman/listinfo/modeller_usage >