- modeller_usage - salilab.org

C0-0rdinate bond generation
by SR.Sathya Baarathi 29 Nov '10

29 Nov '10

2 1

Modeling ...
by bharat lal 29 Nov '10

29 Nov '10

Hi Everybody, I want to insert a peptide fragment into one of the loops of my template protein structure .. Can anybody tell me how can I do it .. Bharat Ph.D. Candidate Room No. : 7202A, 2nd Floor Biomolecular Engineering Laboratory Division of Chemical Engineering and Polymer Science Pusan National University Busan -609735 South Korea Lab phone no. - +82-51-510-3680, +82-51-583-8343 E-mail : monu46010(a)yahoo.com

2 1

measure protein stability
by Knut J Bjuland 29 Nov '10

29 Nov '10

I have designed a homolog protein with sequence identity above 90 %? How can I measure protein stabilty and it ability to form aggreation. An example would be amyloid plage which aggregat in Alzheimer disease? Can I use dope score to measure protein stability or should I turn to rosetta desginer? Knut J

2 1

Heme iron
by flavio seixas 29 Nov '10

29 Nov '10

Hi, I am modellig a structure of an hemoglobin with the four heme groups bonded to oxygen. To do the alignment I refer to heme as "h" and oxygen as "o". The template model is the oxy hemoglobin at 1.25 Angstrons resolution Pdb id: 2DN1. The final model has heme and oxygen, but the iron configuration is OUT of the plane of porphyrin ring toward proxymal His which is bonded to iron. This configuration is different as observed in oxygen ligated form of hemoglobin in which the iron is in the SAME plane of the porphyrin ring. In summary, the final model has an heme group in a configuration observed in deoxy form (iron out of the porphyrin plane). I wish it looks like appears in oxy form (iron inside the porphyrin plane). I appreciate any kind of suggestions. Flavio

2 1

umber of equivalent positions < 3
by bharat lakhani 29 Nov '10

29 Nov '10

Hi Everyone, I am getting this error, when i am running modeller. i posted this mail before but i did not get any reply. looking forward to it Traceback (most recent call last): File "compare_1.py", line 32, in ? aln.malign3d() File "/usr/lib/modeller9v8/modlib/modeller/alignment.py", line 329, in malign3d edit_file_ext) _modeller.ModellerError: fit2xyz_296E> Number of equivalent positions < 3: 1

2 1

Re: [modeller_usage] high model clashscore
by Nick Burton 22 Nov '10

22 Nov '10

Hello, I have found that, in many cases, switching on the Lennard-Jones restraint (energy_data.dynamic_lennard = True) and up-weighting it with respect to other restraints (env.schedule_scale...) can reduce the bad van der Waal's interactions as measured by Molprobity. Cheers, Nick On 20 November 2010 13:03, Anton Iershov <" target="_blank">a.yershov(a)yahoo.com> wrote: Dear Modeller Caretaker, When performing homology modeling with default parameters ("model-default.py") and subsequent analysis with Molprobity (http://molprobity.biochem.duke.edu/) I obtain models with much more high clashscore than the template has, and model optimization does not help much. Then, Kinemage (http://kinemage.biochem.duke.edu) shows a lot of "bad" van der Waals contacts. What should I do to obtain model of higher quality (I mean to reduce clashscore and number of "bad" contacts)? Thanks in advance, Anton. ---------------------- Dr N M Burton Department of Biochemistry University of Bristol BS8 1TD, UK +44 117 3312149 nick.burton(a)bristol.ac.uk

1 0

high model clashscore
by Anton Iershov 20 Nov '10

20 Nov '10

Dear Modeller Caretaker,When performing homology modeling with default parameters ("model-default.py") and subsequent analysis with Molprobity (http://molprobity.biochem.duke.edu/) I obtain models with much more high clashscore than the template has, and model optimization does not help much.Then, Kinemage (http://kinemage.biochem.duke.edu) shows a lot of "bad" van der Waals contacts.What should I do to obtain model of higher quality (I mean to reduce clashscore and number of "bad" contacts)? Thanks in advance,Anton.

2 1

Re: [modeller_usage] extracting sequence from PDB rather than using associated fasta
by Irene Newhouse 19 Nov '10

19 Nov '10

Thanks so much for the URL to the scripts! That's just the tool I need. Irene

1 0

last residue no. when there are x-ray invisible residues
by Irene Newhouse 18 Nov '10

18 Nov '10

Now that, thanks to you, I've got the order of chain/residue number in the pir file fixed, I'm random walking my way through other errors. I had to drop one of my matches because there are differences between the sequence as deposited in the PDB & the pdb file[!] [At least that has nothing to do with me]. Now another of my matches is giving me fits. It has missing residues 74-85. I carefully replaced them with -, but I'm still getting the same mismatch error message that I got before I did that. I'm wondering if I have to alter the final residue number in line 2 of the entry for that protein. I have 242, which is the position of the last residue in the sequence, but the pdb file's residue numbers jump from 73 to 86, reflecting the missing residues. I can just drop this entry from the multi-alignment I'm using, which would make the 'casualty rate' 40%, so I'd rather understand better how to fix this issue correctly. I already checked, & this is the only deposited structure for that protein, so it's either fix it or drop it. Thanks! Irene Newhouse

2 1

more sequence difference issues
by Irene Newhouse 18 Nov '10

18 Nov '10

In the interests of appearing to make progress, I dropped the alignment of which I wrote an hour or so ago from the mulitple alignments considered. Now I have another sequence difference issue with 1x06.pdb. This is how it aligns with my sequence [clustal w server pir output, with line 2 edited by hand] :>P1;1x06structureX:1x06:12:A:240:A:UPP :Erischeria coli : :-------------------------------------MMLSATQPLSEKLPAHGCR-HVAIIMDGNGRWAKKQGK-IRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALD---SEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQ----GNLQPDQIDEEMLNQHVCMHELA------------------PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETAI checked it myself against the original fasta sequence deposited in the pdb & can't find any differences. The only missing residues are those below 12 & above 240. I scrolled through the pdb file & can't find any residues missing that might not have been noted in the header. Is there a way to get more detailed information on the problem region, or a tool to check fasta sequences against a pdb file? Thanks! IreneThe relevant end of the error log is:Dynamically allocated memory at amaxstructure [B,KiB,MiB]: 3879167 3788.249 3.699read_te_291E> Sequence difference between alignment and pdb : x (mismatch at alignment position 1) Alignment MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSF PDB KLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTL Match * * * * * Alignment residue type 11 (M, MET) does not match pdb residue type 9 (K, LYS), for align code 1x06 (atom file 1x06), pdb residue number "12", chain "A" Please check your alignment file header to be sure you correctly specified the starting and ending residue numbers and chains. The alignment sequence must match that from the atom file exactly. Another possibility is that some residues in the atom file are missing, perhaps because they could not be resolved experimentally. (Note that Modeller reads only the ATOM and HETATM records in PDB, NOT the SEQRES records.) In this case, simply replace the section of your alignment corresponding to these missing residues with gaps.read_te_288W> Protein not accepted: 3 1x06

3 2