- modeller_usage - salilab.org

read_al_373E> Protein specified in ALIGN_CODES(i) was not found in the alignment file
by Andrea Spinelli 16 Jan '18

16 Jan '18

Hello everybody! I am new to Modeller, so please excuse me if my question seems stupid. I build a model from multiple templates following your tutorial (https://salilab.org/modeller/tutorial/advanced.html) It's working. When I try to develop a module function with scripts, the 'align2d_mult.py' give me the following error: ModellerError: read_al_373E> Protein specified in ALIGN_CODES(i) was not found in the alignment file; ALIGN_CODES( 3) = P02489 I can't understand because my sequence.ali file is built in the right way: >P1;P02489 sequence:P02489:::::::0.00: 0.00 MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS* In attached you can find the python module with the function of script Thank you. Andrea

3 7

mail about an error
by vidhya sankar 02 Jan '18

02 Jan '18

Dear users I am beginner of modeller when i do basic homology modeling i got error as follows read_te_291E> Sequence difference between alignment and pdb : x (mismatch at alignment position 1) Alignment MNQVQRSNELSQERTARLNELQRALVMMDSDFRQIALRQTRTNGEEPSKKLLHWA PDB TVGYLEQKMFAAMVADNQMAMVMLNPKNLKASNGEEELAGQTWYWKVAPVATTQP Match * Alignment residue type 11 (M, MET) does not match pdb residue type 17 (T, THR), for align code 2ret (atom file 2ret), pdb residue number "30", chain "A" Please check your alignment file header to be sure you correctly specified the starting and ending residue numbers and chains. The alignment sequence must match that from the atom file exactly. Even i searched the mailing list i got information but i am not able to understand error . Please is very useful if you point out where i have committed the mistake Thanks in advance with high regardsS.vidhyasnakr

2 1

grid_search and hetatm
by Carlo Camilloni 21 Dec '17

21 Dec '17

Dear Modellers I am fitting a protein with cofactors in a cryo-em density using grid_search. It works but the fitted structure does’t include anymore the HETATM fields with the cofactors. My input looks env = environ() env.io.hetatm = True env.libs.topology.read(file='$(LIB)/top_heav.lib') # read topology env.libs.parameters.read(file='$(LIB)/par.lib') # read parameters … den.grid_search(em_density_format='MRC', num_structures=1, em_pdb_name=struct, chains_num=[1], start_type='SPECIFIC', number_of_steps=1000, angular_step_size=30., temperature=150., best_docked_models=1, translate_type='RANDOM', em_fit_output_file='modem.log’) Is this something that is not supported or I am doing something wrong? Best, Carlo _______ Department of Biosciences University of Milano Via Celoria 26 - 20133 Milano, Italy www: sites.unimi.it/camilloni <http://sites.unimi.it/camilloni> www: bioscienze.bio <http://bioscienzebio.unimi.it/>

2 1

error in running mod9.19
by Saman Yousuf Ali 04 Dec '17

04 Dec '17

I have recently installed modeller 9.19 in my windows system with python 3.63 (64-bit). It was running perfectly fine. Even yesterday,I run basic modelling tutorial but now when I run command mod9.19 build_profile.py It gives me following error; 'md9.19' is not recognized as an internal and external command, operable program or batch file. Kindly help me to fix this issue. Regards Saman

2 1

Disulphide bonds forming with several cysteines
by Lenka 06 Nov '17

06 Nov '17

Hello everybody, I am having a problem with my model. I am new to Modeller but I googled and couldn't find an answer. I am selecting the residues I want to form the disulphide bonds but there is a one cys that gets in a way and when I visualize the disulphides in Pymol, I can see three cysteines are bonded together. How can I prevent that? Here are my patches: class MyModel(automodel): def special_patches(self, aln): self.patch(residue_type='DISU', residues=(self.residues['76'], self. residues['241'])) self.patch(residue_type='DISU', residues=(self.residues['46'], self. residues['122'])) self.patch(residue_type='DISU', residues=(self.residues['188'], self.residues['206'])) self.patch(residue_type='DISU', residues=(self.residues['105'], self.residues['202'])) self.patch(residue_type='DISU', residues=(self.residues['265'], self.residues['228'])) self.patch(residue_type='DISU', residues=(self.residues['113'], self.residues['183'])) self.patch(residue_type='DISU', residues=(self.residues['127'], self.residues['171'])) Since Modeller only reads ATOM and HETEATOM records I dont really understand why is this happening. Thank you for any help!

2 1

Help with Modelface
by Daravuth Cheam 25 Oct '17

25 Oct '17

Hi, I recently installed Modelface, and I'm having issues trying to get it set up. It first prompts me to enter the password, followed by the Modeller version and installation path of Modeller. I am able to enter the password and Modeller version (version 9.19), but I can't get the installation path of Modeller correct. I entered the default path which is C:\Program Files\Modeller9.19, but I got a message saying "Modeller executables were not found." I checked to make sure that the Modeller9.19 folder is in Program Files, and it is. The Modeller.exe file is specifically within the x86_64-w64 folder found in C:\Program Files\Modeller9.19\lib\x86_64-w64\mod9.19. I tried typing this in the command prompt, but I got the same "Modeller executables were not found" message. Any help with this would be appreciated. Thanks in advance! Sincerely, Daravuth Cheam Portland State University Biology Department The Estes Lab

2 1

Modeller Hardware specifications
by arturossi 26 Sep '17

26 Sep '17

Greetings, I'm Artur, and I'm responsible for the administration of the MHOLline 2 web site (www.mholline2.lncc.br) which has been designed for protein modelling and automation to the scientific community. We are changing our servers to suit better our needs and I'm collecting hardware specifications for all softwares that we use so we can provide a better service to scientific community. From what I've searched about the Modeller, I've not been able to find a recent hardware specifications. Since Modeller is quite used in our servers, it's important to choose the hardware according to the its needs. Which is the recommended hardware specification to run Modeller within a server? Thank you, Artur Duque Rossi Colaborador Grupo de Modelagem Molecular de Sistemas Biológicos Laboratório Nacional de Computação Científica (LNCC) Av. Getúlio Vargas, 333, Bloco A, Sala 1A42 Quitandinha, CEP: 25651-075 Petrópolis - RJ, Brasil Telefone: +55 (24) 2233-6179

2 1

Multimeric Protein Modelling
by Ryan Ehrlich 15 Sep '17

15 Sep '17

Hello Modellers, I'm running into issues when modelling a multimeric (2 chains) protein. When using the multi-chain modelling example seen in the online manual (see below) it throws an error because the monomers aren't the same length, per the special_restraints(). How can I resolve this issue? Regards, Ryan # Comparative modeling by the automodel class## Demonstrates how to build multi-chain models, and symmetry restraints#from modeller import *from modeller.automodel import * # Load the automodel class log.verbose() # Override the 'special_restraints' and 'user_after_single_model' methods:class MyModel(automodel): def special_restraints(self, aln): # Constrain the A and B chains to be identical (but only restrain # the C-alpha atoms, to reduce the number of interatomic distances # that need to be calculated): s1 = selection(self.chains['A']).only_atom_types('CA') s2 = selection(self.chains['B']).only_atom_types('CA') self.restraints.symmetry.append(symmetry(s1, s2, 1.0)) def user_after_single_model(self): # Report on symmetry violations greater than 1A after building # each model: self.restraints.symmetry.report(1.0) env = environ()# directories for input atom filesenv.io.atom_files_directory = ['.', '../atom_files'] # Be sure to use 'MyModel' rather than 'automodel' here!a = MyModel(env, alnfile = 'twochain.ali' , # alignment filename knowns = '2abx', # codes of the templates sequence = '1hc9') # code of the target a.starting_model= 1 # index of the first modela.ending_model = 1 # index of the last model # (determines how many models to calculate)a.make() # do comparative modeling

2 1

Multi-chain/multi-template Modeling
by Ryan Ehrlich 08 Sep '17

08 Sep '17

Hey there Modellers, I appreciate the input I received from my previous questions, but have run into something I need more clarification on. I'm attempting to product models using multiple templates and multiple chains. I'll detail my steps below: Step 1: Build individual chain profiles using build_profile.py, as seen in the basic tutorial (select PDBs based on e-val and identity thresholds). Step 2: Use the multiple template salign.py program as seen in the advanced tutorial (the first script in the tutorial), on PDBs selected in step 1. Step 3: Here I attempted to combine alignment profiles. I wrote a quick python script to do so. I'll show a snippet of the output below, please note that some structures only offer one chain that could be used as a template, if this was the case I use a hyphen a placeholder... which I think is the source of at least one of my problems. >P1;2bnu structure:2bnu: 1 :A:252 :B:::-1.00:-1.00 --QEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRST LYIAASQPGDSATYLCAVRPTSGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRRSKSSDKSVCLFTDFDSQTNVS QSKD--SDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS-----/ --GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFP LRLLSAAPSQTSVYFCASSYVG-N-TGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATG FYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWT QDRAKPVTQIVSAEAWGRAD-------* >P1;5bs0 structure:5bs0: 1 :D:252 :E:::-1.00:-1.00 -AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLYVRPYQREQTSGRLNASLDKSSGRST LYIAASQPGDSATYLCAVRPGGAGPFFVVFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVS QSKD--SDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP------------/ --------------------------------------------------------------------------- --------------------------------------------------------------------------- --------------------------------------------------------------------------- ---------------------------* >P1;4grm structure:4grm: 1 :A:252 :B:::-1.00:-1.00 -------------------------------------------------------------------------- -------------------------------------------------------------------------- --------------------------------------------------------------/ --GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFP LRLLSAAPSQTSVYFCASRPGL---QPEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATG FYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWT QDRAKPVTQIVSAEAWGRAD-------* >P1;2pye sequence:2pye: 1 :A:252 :B:::-1.00:-1.00 MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGSST LYIAASQPGDSATYLCAVRPLLDGTYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVS QSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNS/ MGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGTTDQGEVPNGYNVSRSTIEDFPL RLLSAAPSQTSVYFCASSYLGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYP DHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDR AKPVTQIVSAEAWGRAD* Step 4: Next, I attempted to use the second salign.py script in the advanced tutorial, hoping for PDB-multi.ali and PDB-multi.prf files which I did not receive. The error code was as seen below: _modeller.ModellerError: rdpdb___303E> No atoms were read from the specified input PDB file, since the starting residue number and/or chain id in MODEL_SEGMENT (or the alignment file header) was not found; requested starting position: residue number " 1", chain " A"; atom file name: 2bnu.pdb I'm assuming this has to do with the pdbID_fit.pdb files outputted by the program in step 2. So am I merging my alignment file too late? I'm also assuming the pdbID_fit.pdb file must contain both chains. Regardless any guidance for producing models from this would be very useful. Best, Ryan

2 1

Fwd: Modelling protein of interest with RNA
by Saravanan Parameswaran 07 Sep '17

07 Sep '17

Modellers, I am trying to model my protein of interest along with RNA in A-form from template. I am encountering problem in modelling . First, the RNA structure is disordered in the model. I think the residue topology of RNA is not assigned I want to model RNA in A-form, since the protein of interest acts mainly on A-form of RNA Please help me out to rectify and model RNA in A-form with my protein of interest Second , a nucleotide is modified (ARA) in the bound RNA with my protein of interest. I want to model it as such, not ligand. I want it to be a modified nucleotide since, modelling it as ligand may bread the RNA strand. Thanks in advance in log file, i found warnings like below. ------------------------------------------------------ read_pd_459W> Residue type 8AZ not recognized. 'automodel' model building will treat this residue as a rigid body. To use real parameters, add the residue type to ${LIB}/restyp.lib, its topology to ${LIB}/top_*.lib, and suitable forcefield parameters to ${LIB}/par.lib. generat_607W> Cannot find params in params file: CHARMM atoms : CN6 ON2 UNDF IUPAC atoms : C3' O3' P Atom indices : 14507 14508 Residues : URA URA 58 atoms in residues without defined topology constrained to be rigid bodies iatmcls_286W> MODEL atom not classified: URA:OP1 URA iatmcls_286W> MODEL atom not classified: URA:OP2 URA iatmcls_286W> MODEL atom not classified: URA:O5' URA iatmcls_286W> MODEL atom not classified: URA:C5' URA iatmcls_286W> MODEL atom not classified: URA:C4' URA iatmcls_286W> MODEL atom not classified: URA:O4' URA iatmcls_286W> MODEL atom not classified: URA:C1' URA iatmcls_286W> MODEL atom not classified: URA:N1 URA iatmcls_286W> MODEL atom not classified: URA:C6 URA iatmcls_286W> MODEL atom not classified: URA:C2 URA iatmcls_286W> MODEL atom not classified: URA:O2 URA iatmcls_286W> MODEL atom not classified: URA:N3 URA iatmcls_286W> MODEL atom not classified: URA:C4 URA iatmcls_286W> MODEL atom not classified: URA:O4 URA iatmcls_286W> MODEL atom not classified: URA:C5 URA iatmcls_286W> MODEL atom not classified: URA:C2' URA iatmcls_286W> MODEL atom not classified: URA:O2' URA iatmcls_286W> MODEL atom not classified: URA:C3' URA iatmcls_286W> MODEL atom not classified: URA:O3' URA iatmcls_286W> MODEL atom not classified: GUA:P GUA iatmcls_286W> MODEL atom not classified: GUA:OP1 GUA iatmcls_286W> MODEL atom not classified: GUA:OP2 GUA iatmcls_286W> MODEL atom not classified: GUA:O5' GUA iatmcls_286W> MODEL atom not classified: GUA:C5' GUA iatmcls_286W> MODEL atom not classified: GUA:C4' GUA iatmcls_286W> MODEL atom not classified: GUA:O4' GUA iatmcls_286W> MODEL atom not classified: GUA:C1' GUA iatmcls_286W> MODEL atom not classified: GUA:N9 GUA iatmcls_286W> MODEL atom not classified: GUA:C4 GUA iatmcls_286W> MODEL atom not classified: GUA:N3 GUA iatmcls_286W> MODEL atom not classified: GUA:C2 GUA iatmcls_286W> MODEL atom not classified: GUA:N1 GUA iatmcls_286W> MODEL atom not classified: GUA:N2 GUA iatmcls_286W> MODEL atom not classified: GUA:C6 GUA iatmcls_286W> MODEL atom not classified: GUA:O6 GUA iatmcls_286W> MODEL atom not classified: GUA:C5 GUA iatmcls_286W> MODEL atom not classified: GUA:N7 GUA iatmcls_286W> MODEL atom not classified: GUA:C8 GUA iatmcls_286W> MODEL atom not classified: GUA:C2' GUA iatmcls_286W> MODEL atom not classified: GUA:O2' GUA iatmcls_286W> MODEL atom not classified: GUA:C3' GUA iatmcls_286W> MODEL atom not classified: GUA:O3' GUA ------------------------------------------------------ Regards, P. Saravanan

2 1