[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index]

[modeller_usage] Generating chimeric protein from templates



Dear Users,

I would like to generate a chimeric protein from templates, especially
following the tips from FAQ 1 (
https://salilab.org/modeller/9.10/manual/node36.html) and also here
https://salilab.org/modeller/9.10/manual/node21.html.

To better understand the code and its meaning, I used two simple sequences
together as test case.
In pir file, it has:

>P1;2xkmA
structureN:2xkm
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
-------------------------------------------*

>P1;4xknE
structureX:4xkh
----------------------------------------------
NGLSEDEALQRALELSLAEAKPQVLSSQEEDDLALAQALSASE*

>P1;test
sequence:test
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
NGLSEDEALQRALELSLAEAKPQVLSSQEEDDLALAQALSASE*

and almost the same for ali file.

However, using the build_profile.py, it shows the first error:
_modeller.FileFormatError: parse_pir__E> Invalid PIR file header line:
structureN:2xkm
There should be 10 fields separated by colons, :
This line actually contains 2 fields.

Now here comes my question, from the FAQ, I thought it was enough to use
two fields for the template?
Even when I put enough colon to make it as 10 fields, it shows the next
error that it could not find the PDB file.
To fix this problem, I tried to put the entire information of the
structureN (and structureX) line from the pdb_95.pir which I download from
the Modeller website,
with the same build_profile.py, the third error comes:
_modeller.StatisticsError: regress_657E> Not enough bins in histogram -
cannot calculate statistics, nbins:        1

In the end, I don't understand the exact problem to cause all these errors,
did miss something in the pir or ali file? or I used the wrong script.
Hope to hear any suggestions from you.

Best wishes.


Dear Users,

I would like to generate a chimeric protein from templates, especially following the tips from FAQ 1 (https://salilab.org/modeller/9.10/manual/node36.html) and also here https://salilab.org/modeller/9.10/manual/node21.html.

To better understand the code and its meaning, I used two simple sequences together as test case.
In pir file, it has:

>P1;2xkmA
structureN:2xkm
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
-------------------------------------------*

>P1;4xknE
structureX:4xkh
----------------------------------------------
NGLSEDEALQRALELSLAEAKPQVLSSQEEDDLALAQALSASE*

>P1;test
sequence:test
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
NGLSEDEALQRALELSLAEAKPQVLSSQEEDDLALAQALSASE*

and almost the same for ali file.

However, using the build_profile.py, it shows the first error:
_modeller.FileFormatError: parse_pir__E> Invalid PIR file header line: structureN:2xkm
There should be 10 fields separated by colons, :
This line actually contains 2 fields.

Now here comes my question, from the FAQ, I thought it was enough to use two fields for the template?
Even when I put enough colon to make it as 10 fields, it shows the next error that it could not find the PDB file.
To fix this problem, I tried to put the entire information of the structureN (and structureX) line from the pdb_95.pir which I download from the Modeller website,
with the same build_profile.py, the third error comes:
_modeller.StatisticsError: regress_657E> Not enough bins in histogram - cannot calculate statistics, nbins:        1

In the end, I don't understand the exact problem to cause all these errors, did miss something in the pir or ali file? or I used the wrong script.
Hope to hear any suggestions from you.

Best wishes.